GSTK1 Antikörper (Middle Region)

Produktnummer ABIN632597

Produktdetails anti-GSTK1 Antikörper

Target: GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSTK1 antibody was raised against the middle region of GSTK1

Aufreinigung: Affinity purified

Immunogen: GSTK1 antibody was raised using the middle region of GSTK1 corresponding to a region with amino acids NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTK1 Blocking Peptide, catalog no. 33R-6755, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTK1

Target: GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))

Andere Bezeichnung: GSTK1 (GSTK1 Produkte)

Synonyme: gst13-13 antikoerper, GSTK1 antikoerper, gstk1 antikoerper, DKFZp459M1330 antikoerper, GST antikoerper, GST 13-13 antikoerper, GST13 antikoerper, GST13-13 antikoerper, GSTK1-1 antikoerper, hGSTK1 antikoerper, 0610025I19Rik antikoerper, AW260476 antikoerper, DsbA-L antikoerper, GSTkappa antikoerper, glutathione S-transferase kappa 1 L homeolog antikoerper, glutathione S-transferase kappa 1 antikoerper, Glutathione S-transferase kappa 1 antikoerper, gstk1.L antikoerper, GSTK1 antikoerper, gstk1 antikoerper, PTRG_07256 antikoerper, Gstk1 antikoerper, LOC100350399 antikoerper

Hintergrund: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.

Molekulargewicht: 25 kDa (MW of target protein)