AGGF1 Antikörper (Middle Region)
-
- Target Alle AGGF1 Antikörper anzeigen
- AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AGGF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AGGF1 antibody was raised against the middle region of AGGF1
- Aufreinigung
- Affinity purified
- Immunogen
- AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
- Top Product
- Discover our top product AGGF1 Primärantikörper
-
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 1-714) antibody
AGGF1 Reaktivität: Human WB, IP, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 461-560) antibodyAGGF1 Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 1-714) antibodyAGGF1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 1-70) antibodyAGGF1 Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 263-507) antibodyAGGF1 Reaktivität: Maus WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) antibodyAGGF1 Reaktivität: Human IF Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 575-624) antibodyAGGF1 Reaktivität: Human, Maus, Meerschweinchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 406-501) antibodyAGGF1 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 21-123) antibodyAGGF1 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1) (AA 470-704) antibodyAGGF1 Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AGGF1 Blocking Peptide, catalog no. 33R-2818, is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGGF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))
- Andere Bezeichnung
- AGGF1 (AGGF1 Produkte)
- Synonyme
- RGD1310888 antikoerper, AGGF1 antikoerper, LOC100037685 antikoerper, im:7146636 antikoerper, zgc:152959 antikoerper, DKFZp459G1317 antikoerper, GPATC7 antikoerper, GPATCH7 antikoerper, HSU84971 antikoerper, HUS84971 antikoerper, VG5Q antikoerper, 2010009L17Rik antikoerper, 2310029P06Rik antikoerper, AW112072 antikoerper, Peg3 antikoerper, angiogenic factor with G patch and FHA domains 1 antikoerper, angiogenic factor with G-patch and FHA domains 1 antikoerper, Aggf1 antikoerper, AGGF1 antikoerper, aggf1 antikoerper, CC1G_06398 antikoerper
- Hintergrund
- The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.
- Molekulargewicht
- 81 kDa (MW of target protein)
-
