TRAPPC1 Antikörper (Middle Region)

Produktnummer ABIN632552

Produktdetails anti-TRAPPC1 Antikörper

Target: TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAPPC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAPPC1 antibody was raised against the middle region of TRAPPC1

Aufreinigung: Affinity purified

Immunogen: TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAPPC1

Target: TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))

Andere Bezeichnung: TRAPPC1 (TRAPPC1 Produkte)

Synonyme: BET5 antikoerper, MUM2 antikoerper, D11Ertd172e antikoerper, zgc:100969 antikoerper, MGC83988 antikoerper, bet5 antikoerper, mum2 antikoerper, trafficking protein particle complex 1 antikoerper, trafficking protein particle complex 1 L homeolog antikoerper, TRAPPC1 antikoerper, Trappc1 antikoerper, trappc1 antikoerper, trappc1.L antikoerper

Hintergrund: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

Molekulargewicht: 17 kDa (MW of target protein)