GPR87 Antikörper (N-Term)

Produktnummer ABIN632486

Produktdetails anti-GPR87 Antikörper

Target: GPR87 (G Protein-Coupled Receptor 87 (GPR87))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR87 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GPR87 antibody was raised against the N terminal of GPR87

Aufreinigung: Affinity purified

Immunogen: GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR87 Blocking Peptide, catalog no. 33R-6027, is also available for use as a blocking control in assays to test for specificity of this GPR87 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR87 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR87

Target: GPR87 (G Protein-Coupled Receptor 87 (GPR87))

Andere Bezeichnung: GPR87 (GPR87 Produkte)

Synonyme: GPR95 antikoerper, KPG_002 antikoerper, G protein-coupled receptor 87 antikoerper, GPR87 antikoerper, Gpr87 antikoerper

Hintergrund: G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: cAMP Metabolic Process