RSL24D1 Antikörper (Middle Region)
-
- Target Alle RSL24D1 Antikörper anzeigen
- RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RSL24D1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C15 ORF15 antibody was raised against the middle region of C15 rf15
- Aufreinigung
- Affinity purified
- Immunogen
- C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED
- Top Product
- Discover our top product RSL24D1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C15ORF15 Blocking Peptide, catalog no. 33R-2931, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))
- Andere Bezeichnung
- C15ORF15 (RSL24D1 Produkte)
- Synonyme
- C15orf15 antikoerper, HRP-L30-iso antikoerper, L30 antikoerper, RLP24 antikoerper, RPL24 antikoerper, RPL24L antikoerper, TVAS3 antikoerper, 2410159K22Rik antikoerper, RGD1309784 antikoerper, c15orf15 antikoerper, wu:fa94f12 antikoerper, wu:fa95d02 antikoerper, zgc:56202 antikoerper, ribosomal L24 domain containing 1 antikoerper, RSL24D1 antikoerper, Rsl24d1 antikoerper, rsl24d1 antikoerper
- Hintergrund
- The function of Chromosome 15 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 19 kDa (MW of target protein)
-