GLOD4 Antikörper (Middle Region)

Produktnummer ABIN632471

Produktdetails anti-GLOD4 Antikörper

Target: GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLOD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLOD4 antibody was raised against the middle region of GLOD4

Aufreinigung: Affinity purified

Immunogen: GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLOD4 Blocking Peptide, catalog no. 33R-4809, is also available for use as a blocking control in assays to test for specificity of this GLOD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLOD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLOD4

Target: GLOD4 (Glyoxalase Domain Containing 4 (GLOD4))

Andere Bezeichnung: GLOD4 (GLOD4 Produkte)

Synonyme: MGC76089 antikoerper, MGC84515 antikoerper, wu:fj45g03 antikoerper, zgc:103490 antikoerper, C17orf25 antikoerper, HC71 antikoerper, 1700082G03Rik antikoerper, 2700085E05Rik antikoerper, C81254 antikoerper, RGD1307010 antikoerper, glyoxalase domain containing 4 antikoerper, glyoxalase domain containing 4 L homeolog antikoerper, glod4 antikoerper, glod4.L antikoerper, GLOD4 antikoerper, Glod4 antikoerper

Hintergrund: The function of GLOD4 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 33 kDa (MW of target protein)