TWF1 Antikörper

Produktnummer ABIN632468

Produktdetails anti-TWF1 Antikörper

Target: TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TWF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TWF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TWF1 Blocking Peptide, catalog no. 33R-6441, is also available for use as a blocking control in assays to test for specificity of this TWF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TWF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TWF1

Target: TWF1 (Twinfilin, Actin-Binding Protein 1 (TWF1))

Andere Bezeichnung: TWF1 (TWF1 Produkte)

Synonyme: A6 antikoerper, PTK9 antikoerper, Ptk9 antikoerper, twinfilin antikoerper, ptk9 antikoerper, twf1 antikoerper, wu:fd02b03 antikoerper, zgc:65922 antikoerper, DKFZp469O1925 antikoerper, CG3771 antikoerper, Dmel\\CG3771 antikoerper, EG:9D2.3 antikoerper, zgc:92472 antikoerper, twinfilin actin binding protein 1 antikoerper, twinfilin actin-binding protein 1a antikoerper, twinfilin actin binding protein 1 S homeolog antikoerper, twinfilin-1 antikoerper, hypothetical protein antikoerper, Twinfilin-1 antikoerper, twinfilin actin-binding protein 1 antikoerper, CG3771 gene product from transcript CG3771-RC antikoerper, twinfilin actin-binding protein 1b antikoerper, TWF1 antikoerper, Twf1 antikoerper, twf1a antikoerper, twf1.S antikoerper, PTRG_09288 antikoerper, PGTG_01788 antikoerper, Tsp_02530 antikoerper, twf1 antikoerper, a6 antikoerper, twf1b antikoerper

Hintergrund: This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Maintenance of Protein Location