CCT5 Antikörper

Produktnummer ABIN632461

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CCT5 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CCT5 Antikörper (ABIN632461)

Target: CCT5 (Chaperonin Containing TCP1, Subunit 5 (Epsilon) (CCT5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCT5 Antikörper

Aufreinigung: Affinity purified

Immunogen: CCT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCT5 Blocking Peptide, (ABIN937258), is also available for use as a blocking control in assays to test for specificity of this CCT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCT5

Target: CCT5 (Chaperonin Containing TCP1, Subunit 5 (Epsilon) (CCT5))

Andere Bezeichnung: CCT5

Hintergrund: CCT5 is a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Molekulargewicht: 60 kDa (MW of target protein)