EXOC6 Antikörper (Middle Region)
-
- Target Alle EXOC6 Antikörper anzeigen
- EXOC6 (Exocyst Complex Component 6 (EXOC6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXOC6 antibody was raised against the middle region of EXOC6
- Aufreinigung
- Affinity purified
- Immunogen
- EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
- Top Product
- Discover our top product EXOC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOC6 Blocking Peptide, catalog no. 33R-10220, is also available for use as a blocking control in assays to test for specificity of this EXOC6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOC6 (Exocyst Complex Component 6 (EXOC6))
- Andere Bezeichnung
- EXOC6 (EXOC6 Produkte)
- Synonyme
- Sec15 antikoerper, Sec15l1 antikoerper, EXOC6A antikoerper, SEC15 antikoerper, SEC15L antikoerper, SEC15L1 antikoerper, SEC15L3 antikoerper, Sec15p antikoerper, 4833405E05Rik antikoerper, AW413330 antikoerper, C430002C19 antikoerper, hbd antikoerper, msec15 antikoerper, zgc:77548 antikoerper, SEC15A antikoerper, EXOC6 antikoerper, 3R41 antikoerper, CG7034 antikoerper, Dmel\\CG7034 antikoerper, dsec15 antikoerper, exocyst complex component 6 antikoerper, exocyst complex component 6B antikoerper, Exocyst complex component 6 antikoerper, Secretory 15 antikoerper, Exoc6 antikoerper, EXOC6 antikoerper, exoc6 antikoerper, LOC410084 antikoerper, EXOC6B antikoerper, CpipJ_CPIJ005438 antikoerper, Tsp_03288 antikoerper, sec-15 antikoerper, Sec15 antikoerper
- Hintergrund
- The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 94 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
-