PLEKHA1 Antikörper (N-Term)
-
- Target Alle PLEKHA1 Antikörper anzeigen
- PLEKHA1 (Pleckstrin Homology Domain Containing, Family A (phosphoinositide Binding Specific) Member 1 (PLEKHA1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLEKHA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLEKHA1 antibody was raised against the N terminal of PLEKHA1
- Aufreinigung
- Affinity purified
- Immunogen
- PLEKHA1 antibody was raised using the N terminal of PLEKHA1 corresponding to a region with amino acids LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ
- Top Product
- Discover our top product PLEKHA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLEKHA1 Blocking Peptide, catalog no. 33R-5226, is also available for use as a blocking control in assays to test for specificity of this PLEKHA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLEKHA1 (Pleckstrin Homology Domain Containing, Family A (phosphoinositide Binding Specific) Member 1 (PLEKHA1))
- Andere Bezeichnung
- PLEKHA1 (PLEKHA1 Produkte)
- Synonyme
- RGD1564153 antikoerper, fc34a05 antikoerper, fc57h12 antikoerper, zgc:55676 antikoerper, wu:fc34a05 antikoerper, wu:fc57h12 antikoerper, MGC83674 antikoerper, PLEKHA1 antikoerper, DKFZp459M1025 antikoerper, TAPP1 antikoerper, AA960558 antikoerper, C920009D07Rik antikoerper, pleckstrin homology domain containing A1 antikoerper, pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1a antikoerper, pleckstrin homology domain containing A1 S homeolog antikoerper, pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 antikoerper, Plekha1 antikoerper, plekha1a antikoerper, PLEKHA1 antikoerper, plekha1.S antikoerper, plekha1 antikoerper
- Hintergrund
- PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-