EIF2B1 Antikörper (C-Term)

Produktnummer ABIN632422

Produktdetails anti-EIF2B1 Antikörper

Target: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF2B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF2 B1 antibody was raised against the C terminal of EIF2 1

Aufreinigung: Affinity purified

Immunogen: EIF2 B1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2B1 Blocking Peptide, catalog no. 33R-1107, is also available for use as a blocking control in assays to test for specificity of this EIF2B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF2B1

Target: EIF2B1 (Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1))

Andere Bezeichnung: EIF2B1 (EIF2B1 Produkte)

Synonyme: DDBDRAFT_0219393 antikoerper, DDBDRAFT_0231375 antikoerper, DDB_0219393 antikoerper, DDB_0231375 antikoerper, 26kDa antikoerper, D5Ertd406e antikoerper, EIF2B antikoerper, EIF2BA antikoerper, eIF-2a antikoerper, translation initiation factor eIF-2B alpha subunit antikoerper, hypothetical protein antikoerper, Translation initiation factor eIF-2B subunit alpha antikoerper, eukaryotic translation initiation factor 2B subunit alpha antikoerper, eukaryotic translation initiation factor 2B, subunit 1 (alpha) antikoerper, eIF2b1 antikoerper, PGTG_05021 antikoerper, ei2ba antikoerper, eif2b1 antikoerper, Eif2b1 antikoerper, EIF2B1 antikoerper

Hintergrund: EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process