C1orf43 Antikörper (Middle Region)

Produktnummer ABIN632395

Produktdetails anti-C1orf43 Antikörper

Target: C1orf43 (Chromosome 1 Open Reading Frame 43 (C1orf43))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF43 antibody was raised against the middle region of C1 rf43

Aufreinigung: Affinity purified

Immunogen: C1 ORF43 antibody was raised using the middle region of C1 rf43 corresponding to a region with amino acids YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF43 Blocking Peptide, catalog no. 33R-10211, is also available for use as a blocking control in assays to test for specificity of this C1ORF43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf43

Target: C1orf43 (Chromosome 1 Open Reading Frame 43 (C1orf43))

Andere Bezeichnung: C1ORF43 (C1orf43 Produkte)

Synonyme: NICE-3 antikoerper, NS5ATP4 antikoerper, S863-3 antikoerper, c1orf43 antikoerper, chromosome 1 open reading frame 43 antikoerper, chromosome 1 open reading frame 43 L homeolog antikoerper, C1orf43 antikoerper, c1orf43.L antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 29 kDa (MW of target protein)