HSD17B14 Antikörper

Produktnummer ABIN632384

Produktdetails anti-HSD17B14 Antikörper

Target: HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSD17B14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HSD17 B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSD17B14 Blocking Peptide, catalog no. 33R-7670, is also available for use as a blocking control in assays to test for specificity of this HSD17B14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSD17B14

Target: HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))

Andere Bezeichnung: HSD17B14 (HSD17B14 Produkte)

Synonyme: Dhrs10 antikoerper, retSDR3 antikoerper, 0610039E24Rik antikoerper, DHRS10 antikoerper, SDR47C1 antikoerper, SDR3 antikoerper, hydroxysteroid (17-beta) dehydrogenase 14 antikoerper, hydroxysteroid 17-beta dehydrogenase 14 antikoerper, Hsd17b14 antikoerper, HSD17B14 antikoerper

Hintergrund: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

Molekulargewicht: 28 kDa (MW of target protein)