COPG Antikörper (N-Term)

Produktnummer ABIN632383

Produktdetails anti-COPG Antikörper

Target: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COPG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COPG antibody was raised against the N terminal of COPG

Aufreinigung: Affinity purified

Immunogen: COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COPG Blocking Peptide, catalog no. 33R-6190, is also available for use as a blocking control in assays to test for specificity of this COPG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COPG

Target: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Andere Bezeichnung: COPG (COPG Produkte)

Synonyme: COPG antikoerper, COPG2 antikoerper, AU019265 antikoerper, BC056168 antikoerper, Copg antikoerper, D6Ertd71e antikoerper, D6Wsu16e antikoerper, copg1 antikoerper, MGC76032 antikoerper, MGC68533 antikoerper, COPG1 antikoerper, coatomer protein complex subunit gamma 1 antikoerper, coatomer protein complex, subunit gamma 1 antikoerper, coatomer protein complex subunit gamma 1 L homeolog antikoerper, coatomer subunit gamma-1 antikoerper, COPG1 antikoerper, Copg1 antikoerper, copg1 antikoerper, copg1.L antikoerper, LOC100050080 antikoerper

Hintergrund: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molekulargewicht: 98 kDa (MW of target protein)