UEVLD Antikörper (Middle Region)
-
- Target Alle UEVLD Antikörper anzeigen
- UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UEVLD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UEVLD antibody was raised against the middle region of UEVLD
- Aufreinigung
- Affinity purified
- Immunogen
- UEVLD antibody was raised using the middle region of UEVLD corresponding to a region with amino acids SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE
- Top Product
- Discover our top product UEVLD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UEVLD Blocking Peptide, catalog no. 33R-8627, is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UEVLD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))
- Andere Bezeichnung
- UEVLD (UEVLD Produkte)
- Synonyme
- ATTP antikoerper, UEV3 antikoerper, 8430408E05Rik antikoerper, Attp antikoerper, UEV and lactate/malate dehyrogenase domains antikoerper, UEVLD antikoerper, Uevld antikoerper
- Hintergrund
- UEVLD is a possible negative regulator of polyubiquitination.
- Molekulargewicht
- 42 kDa (MW of target protein)
-