UFL1 Antikörper (Middle Region)
-
- Target Alle UFL1 Antikörper anzeigen
- UFL1 (UFM1-Specific Ligase 1 (UFL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UFL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIAA0776 antibody was raised against the middle region of KIAA0776
- Aufreinigung
- Affinity purified
- Immunogen
- KIAA0776 antibody was raised using the middle region of KIAA0776 corresponding to a region with amino acids EYLIKPLNKTYLEVVRSVFMSSTTSASGTGRKRTIKDLQEEVSNLYNNIR
- Top Product
- Discover our top product UFL1 Primärantikörper
-
anti-UFM1-Specific Ligase 1 (UFL1) antibody
UFL1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-UFM1-Specific Ligase 1 (UFL1) (AA 426-455) antibodyUFL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB24469 unconjugated
anti-UFM1-Specific Ligase 1 (UFL1) antibodyUFL1 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-UFM1-Specific Ligase 1 (UFL1) (AA 503-552) antibodyUFL1 Reaktivität: Human, Maus, Pferd, Rind (Kuh), Kaninchen, Hund, Ratte, Meerschweinchen, Schwein, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIAA0776 Blocking Peptide, catalog no. 33R-2824, is also available for use as a blocking control in assays to test for specificity of this KIAA0776 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0776 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UFL1 (UFM1-Specific Ligase 1 (UFL1))
- Andere Bezeichnung
- KIAA0776 (UFL1 Produkte)
- Synonyme
- 1810074P20Rik antikoerper, AI429228 antikoerper, Kiaa0776 antikoerper, Maxer antikoerper, Rcad antikoerper, mKIAA0776 antikoerper, KIAA0776 antikoerper, NLBP antikoerper, RCAD antikoerper, RP3-393D12.1 antikoerper, RGD1309308 antikoerper, zgc:63562 antikoerper, UFM1 specific ligase 1 antikoerper, Ufm1-specific ligase 1 antikoerper, UFM1-specific ligase 1 antikoerper, Ufl1 antikoerper, UFL1 antikoerper, ufl1 antikoerper
- Hintergrund
- KIAA0776 is an E3 UFM1-protein ligase that mediates ufmylation of target proteins such as DDRGK1/C20orf116. The function of ufmylation is unknown.
- Molekulargewicht
- 89 kDa (MW of target protein)
-
