FBXO22 Antikörper (Middle Region)
-
- Target Alle FBXO22 Antikörper anzeigen
- FBXO22 (F-Box Protein 22 (FBXO22))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO22 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO22 antibody was raised against the middle region of FBXO22
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO22 antibody was raised using the middle region of FBXO22 corresponding to a region with amino acids CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE
- Top Product
- Discover our top product FBXO22 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO22 Blocking Peptide, catalog no. 33R-1651, is also available for use as a blocking control in assays to test for specificity of this FBXO22 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO22 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO22 (F-Box Protein 22 (FBXO22))
- Andere Bezeichnung
- FBXO22 (FBXO22 Produkte)
- Synonyme
- FBXO22 antikoerper, DKFZp469L0535 antikoerper, fbxo22 antikoerper, MGC146708 antikoerper, si:busm1-132m23.3 antikoerper, FBX22 antikoerper, FISTC1 antikoerper, 0610033L19Rik antikoerper, 1600016C16Rik antikoerper, F-box protein 22 antikoerper, FBXO22 antikoerper, fbxo22 antikoerper, Fbxo22 antikoerper
- Hintergrund
- FBXO22 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO22 belongs to the Fbxs class. Two transcript variants encoding different isoforms exist for this gene.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-