GRIPAP1 Antikörper (N-Term)

Produktnummer ABIN632287

Produktdetails anti-GRIPAP1 Antikörper

Target: GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRIPAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRIPAP1 antibody was raised against the N terminal of GRIPAP1

Aufreinigung: Affinity purified

Immunogen: GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRIPAP1 Blocking Peptide, catalog no. 33R-2618, is also available for use as a blocking control in assays to test for specificity of this GRIPAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIPAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRIPAP1

Target: GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))

Andere Bezeichnung: GRIPAP1 (GRIPAP1 Produkte)

Synonyme: gripap1 antikoerper, MGC184827 antikoerper, zgc:158787 antikoerper, GRASP-1 antikoerper, AI854681 antikoerper, DXImx47e antikoerper, Sfc10 antikoerper, mKIAA1167 antikoerper, Grasp1 antikoerper, GRIP1 associated protein 1 antikoerper, gripap1 antikoerper, GRIPAP1 antikoerper, Gripap1 antikoerper

Hintergrund: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms, however, the full-length nature and biological validity of all of these variants have not been determined.

Molekulargewicht: 96 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom