PRKAB2 Antikörper (Middle Region)
-
- Target Alle PRKAB2 Antikörper anzeigen
- PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKAB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKAB2 antibody was raised against the middle region of PRKAB2
- Aufreinigung
- Affinity purified
- Immunogen
- PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA
- Top Product
- Discover our top product PRKAB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKAB2 Blocking Peptide, catalog no. 33R-7854, is also available for use as a blocking control in assays to test for specificity of this PRKAB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))
- Andere Bezeichnung
- PRKAB2 (PRKAB2 Produkte)
- Synonyme
- prkab2 antikoerper, MGC64365 antikoerper, PRKAB2 antikoerper, DKFZp469M1118 antikoerper, 5730553K21Rik antikoerper, AW049591 antikoerper, BB124140 antikoerper, protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog antikoerper, protein kinase AMP-activated non-catalytic subunit beta 2 antikoerper, protein kinase, AMP-activated, beta 2 non-catalytic subunit antikoerper, prkab2.L antikoerper, PRKAB2 antikoerper, prkab2 antikoerper, Prkab2 antikoerper
- Hintergrund
- The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Warburg Effekt
-