IFRD1 Antikörper (Middle Region)
-
- Target Alle IFRD1 Antikörper anzeigen
- IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IFRD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IFRD1 antibody was raised against the middle region of IFRD1
- Aufreinigung
- Affinity purified
- Immunogen
- IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
- Top Product
- Discover our top product IFRD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IFRD1 Blocking Peptide, catalog no. 33R-4784, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFRD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))
- Andere Bezeichnung
- IFRD1 (IFRD1 Produkte)
- Synonyme
- im:7067566 antikoerper, si:dkey-192l17.2 antikoerper, wu:fi35f04 antikoerper, wu:fj67a06 antikoerper, zgc:154080 antikoerper, IFR1 antikoerper, PC4 antikoerper, TIS7 antikoerper, Ifnl antikoerper, Tis7 antikoerper, Pc4 antikoerper, interferon-related developmental regulator 1 antikoerper, interferon related developmental regulator 1 L homeolog antikoerper, interferon related developmental regulator 1 antikoerper, ifrd1 antikoerper, ifrd1.L antikoerper, IFRD1 antikoerper, Ifrd1 antikoerper
- Hintergrund
- IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.
- Molekulargewicht
- 50 kDa (MW of target protein)
-