MYL9 Antikörper (Middle Region)

Produktnummer ABIN632242

Produktdetails anti-MYL9 Antikörper

Target: MYL9 (Myosin Regulatory Light Chain 2, Smooth Muscle Isoform (MYL9))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYL9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MYL9 antibody was raised against the middle region of MYL9

Aufreinigung: Affinity purified

Immunogen: MYL9 antibody was raised using the middle region of MYL9 corresponding to a region with amino acids FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYL9 Blocking Peptide, catalog no. 33R-2863, is also available for use as a blocking control in assays to test for specificity of this MYL9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYL9

Target: MYL9 (Myosin Regulatory Light Chain 2, Smooth Muscle Isoform (MYL9))

Andere Bezeichnung: MYL9 (MYL9 Produkte)

Synonyme: LC20 antikoerper, MLC-2C antikoerper, MLC2 antikoerper, MRLC1 antikoerper, MYRL2 antikoerper, AI327049 antikoerper, MLC20 antikoerper, Mylc2c antikoerper, RLC-C antikoerper, myosin antikoerper, regulatory antikoerper, MRCL3 antikoerper, MRLC2 antikoerper, MYL9 antikoerper, zgc:103467 antikoerper, myl9 antikoerper, zgc:77916 antikoerper, myosin light chain 9 antikoerper, myosin, light polypeptide 9, regulatory antikoerper, myosin light chain 9 L homeolog antikoerper, myosin, light chain 9, regulatory antikoerper, myosin, light chain 12A, regulatory, non-sarcomeric antikoerper, myosin, light chain 9a, regulatory antikoerper, myosin, light chain 9b, regulatory antikoerper, MYL9 antikoerper, Myl9 antikoerper, myl9.L antikoerper, MYL12A antikoerper, myl9a antikoerper, myl9b antikoerper

Hintergrund: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains.

Molekulargewicht: 20 kDa (MW of target protein)