CSNK2A1/CK II alpha Antikörper (C-Term)
-
- Target Alle CSNK2A1/CK II alpha (CSNK2A1) Antikörper anzeigen
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSNK2A1/CK II alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CK2 alpha antibody was raised against the C terminal of CSNK2 A2
- Aufreinigung
- Affinity purified
- Immunogen
- CK2 alpha antibody was raised using the C terminal of CSNK2 A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
- Top Product
- Discover our top product CSNK2A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CK2 alpha Blocking Peptide, catalog no. 33R-3605, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
- Andere Bezeichnung
- CK2 alpha (CSNK2A1 Produkte)
- Synonyme
- CK2A2 antikoerper, CSNK2A1 antikoerper, CK2A1 antikoerper, CKII antikoerper, CSNK2A3 antikoerper, CK2A antikoerper, Ck2a antikoerper, BmCK2a antikoerper, wu:fi38e04 antikoerper, wu:fi38h03 antikoerper, csnk2a1 antikoerper, CK-II antikoerper, CK2 antikoerper, Ckiialpha antikoerper, Csnk2a1-rs4 antikoerper, ck2a1 antikoerper, casein kinase 2 alpha 2 antikoerper, casein kinase 2 alpha 1 antikoerper, casein kinase 2 alpha subunit antikoerper, casein kinase 2, alpha 1 polypeptide antikoerper, CK2 protein kinase alpha 2 antikoerper, casein kinase II alpha subunit antikoerper, Casein kinase II alpha subunit antikoerper, casein kinase 2, alpha 1 polypeptide S homeolog antikoerper, CSNK2A2 antikoerper, CSNK2A1 antikoerper, ck2a antikoerper, Ck2a antikoerper, csnk2a1 antikoerper, cka2 antikoerper, Ckiialpha antikoerper, CK2A1 antikoerper, Csnk2a1 antikoerper, csnk2a1.S antikoerper
- Hintergrund
- CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-