GNGT2 Antikörper (Middle Region)
-
- Target Alle GNGT2 Antikörper anzeigen
- GNGT2 (Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GNGT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GNGT2 antibody was raised against the middle region of Gngt2
- Aufreinigung
- Affinity purified
- Immunogen
- GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
- Top Product
- Discover our top product GNGT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GNGT2 Blocking Peptide, catalog no. 33R-4362, is also available for use as a blocking control in assays to test for specificity of this GNGT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNGT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNGT2 (Guanine Nucleotide Binding Protein (G Protein), gamma Transducing Activity Polypeptide 2 (GNGT2))
- Andere Bezeichnung
- GNGT2 (GNGT2 Produkte)
- Synonyme
- G-GAMMA-8 antikoerper, G-GAMMA-C antikoerper, GNG8 antikoerper, GNG9 antikoerper, GNGT8 antikoerper, AV096488 antikoerper, gngt2 antikoerper, id:ibd1139 antikoerper, wu:fk53d05 antikoerper, G protein subunit gamma transducin 2 antikoerper, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 antikoerper, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2a antikoerper, GNGT2 antikoerper, Gngt2 antikoerper, gngt2a antikoerper
- Hintergrund
- Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.
- Molekulargewicht
- 8 kDa (MW of target protein)
-