RRAGD Antikörper (Middle Region)

Produktnummer ABIN632202

Produktdetails anti-RRAGD Antikörper

Target: RRAGD (Ras-Related GTP Binding D (RRAGD))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRAGD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RRAGD antibody was raised against the middle region of RRAGD

Aufreinigung: Affinity purified

Immunogen: RRAGD antibody was raised using the middle region of RRAGD corresponding to a region with amino acids CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRAGD Blocking Peptide, catalog no. 33R-1669, is also available for use as a blocking control in assays to test for specificity of this RRAGD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRAGD

Target: RRAGD (Ras-Related GTP Binding D (RRAGD))

Andere Bezeichnung: RRAGD (RRAGD Produkte)

Synonyme: RAGD antikoerper, bA11D8.2.1 antikoerper, 5730543C08Rik antikoerper, AI467523 antikoerper, C030003H22Rik antikoerper, D4Ertd174e antikoerper, Ras related GTP binding D antikoerper, Ras-related GTP binding D antikoerper, RRAGD antikoerper, Rragd antikoerper

Hintergrund: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Molekulargewicht: 45 kDa (MW of target protein)