COPS4 Antikörper
-
- Target Alle COPS4 Antikörper anzeigen
- COPS4 (COP9 Signalosome Subunit 4 (COPS4))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COPS4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- COPS4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA
- Top Product
- Discover our top product COPS4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COPS4 Blocking Peptide, catalog no. 33R-10150, is also available for use as a blocking control in assays to test for specificity of this COPS4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPS4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COPS4 (COP9 Signalosome Subunit 4 (COPS4))
- Andere Bezeichnung
- COPS4 (COPS4 Produkte)
- Synonyme
- CG8725 antikoerper, CH4 antikoerper, Cops4 antikoerper, Csn4 antikoerper, DCH4 antikoerper, Dch4 antikoerper, Dmel\\CG8725 antikoerper, csn4 antikoerper, l(2)k08018 antikoerper, COPS4 antikoerper, SGN4 antikoerper, DKFZp459H0324 antikoerper, AW208976 antikoerper, D5Ertd774e antikoerper, fc90c08 antikoerper, wu:fc90c08 antikoerper, zgc:77137 antikoerper, ATS4 antikoerper, CONSTITUTIVE PHOTOMORPHOGENIC 14 antikoerper, CONSTITUTIVE PHOTOMORPHOGENIC 8 antikoerper, COP14 antikoerper, COP9 SIGNALOSOME SUBUNIT 4 antikoerper, CSN4 antikoerper, EMB134 antikoerper, EMBRYO DEFECTIVE 134 antikoerper, FUS4 antikoerper, FUS8 antikoerper, FUSCA 4 antikoerper, FUSCA 8 antikoerper, MBD2.17 antikoerper, MBD2_17 antikoerper, COS41.8 antikoerper, COP9 signalosome subunit 4 antikoerper, COP9 signalosome complex subunit 4 antikoerper, COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis) antikoerper, Proteasome component (PCI) domain protein antikoerper, COP9 signalosome subunit 4 L homeolog antikoerper, CSN4 antikoerper, COPS4 antikoerper, CpipJ_CPIJ000966 antikoerper, csn4 antikoerper, Cops4 antikoerper, cops4 antikoerper, COP8 antikoerper, cops4.L antikoerper, csn-4 antikoerper
- Hintergrund
- COPS4 is one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Zellzyklus
-