QRSL1 Antikörper

Produktnummer ABIN632152

Produktdetails anti-QRSL1 Antikörper

Target: QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser QRSL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

QRSL1 Blocking Peptide, catalog no. 33R-8956, is also available for use as a blocking control in assays to test for specificity of this QRSL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QRSL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu QRSL1

Target: QRSL1 (Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1))

Andere Bezeichnung: QRSL1 (QRSL1 Produkte)

Synonyme: 0929/02 antikoerper, CG6007 antikoerper, Dmel\\CG6007 antikoerper, bene antikoerper, benedict antikoerper, l(3)S092902 antikoerper, wu:fi03b10 antikoerper, GatA antikoerper, 2700038P16Rik antikoerper, C80053 antikoerper, Glutamyl-tRNA amidotransferase, subunit A antikoerper, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 antikoerper, glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1 L homeolog antikoerper, GatA antikoerper, qrsl1 antikoerper, qrsl1.L antikoerper, QRSL1 antikoerper, Qrsl1 antikoerper

Hintergrund: The function of the QRSL1 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 57 kDa (MW of target protein)