RTDR1 Antikörper (Middle Region)

Produktnummer ABIN632124

Produktdetails anti-RTDR1 Antikörper

Target: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RTDR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RTDR1 antibody was raised against the middle region of RTDR1

Aufreinigung: Affinity purified

Immunogen: RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RTDR1 Blocking Peptide, catalog no. 33R-3896, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RTDR1

Target: RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))

Andere Bezeichnung: RTDR1 (RTDR1 Produkte)

Synonyme: 4933431K05Rik antikoerper, si:dkey-220o5.4 antikoerper, radial spoke head 14 homolog antikoerper, rtdr1, putative antikoerper, radial spoke head homolog 14 (Chlamydomonas) antikoerper, radial spoke head 14 homolog (Chlamydomonas) antikoerper, RSPH14 antikoerper, Smp_151730 antikoerper, Rsph14 antikoerper, rsph14 antikoerper

Hintergrund: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.

Molekulargewicht: 38 kDa (MW of target protein)