RTDR1 Antikörper (Middle Region)
-
- Target Alle RTDR1 Antikörper anzeigen
- RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RTDR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RTDR1 antibody was raised against the middle region of RTDR1
- Aufreinigung
- Affinity purified
- Immunogen
- RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA
- Top Product
- Discover our top product RTDR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RTDR1 Blocking Peptide, catalog no. 33R-3896, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTDR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RTDR1 (Rhabdoid Tumor Deletion Region Gene 1 (RTDR1))
- Andere Bezeichnung
- RTDR1 (RTDR1 Produkte)
- Synonyme
- 4933431K05Rik antikoerper, si:dkey-220o5.4 antikoerper, radial spoke head 14 homolog antikoerper, rtdr1, putative antikoerper, radial spoke head homolog 14 (Chlamydomonas) antikoerper, radial spoke head 14 homolog (Chlamydomonas) antikoerper, RSPH14 antikoerper, Smp_151730 antikoerper, Rsph14 antikoerper, rsph14 antikoerper
- Hintergrund
- This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
- Molekulargewicht
- 38 kDa (MW of target protein)
-