C16orf61 Antikörper (Middle Region)

Produktnummer ABIN632088

Produktdetails anti-C16orf61 Antikörper

Target: C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C16orf61 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 ORF61 antibody was raised against the middle region of C16 rf61

Aufreinigung: Affinity purified

Immunogen: C16 ORF61 antibody was raised using the middle region of C16 rf61 corresponding to a region with amino acids NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16ORF61 Blocking Peptide, catalog no. 33R-6726, is also available for use as a blocking control in assays to test for specificity of this C16ORF61 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF61 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C16orf61

Target: C16orf61 (Chromosome 16 Open Reading Frame 61 (C16orf61))

Andere Bezeichnung: C16ORF61 (C16orf61 Produkte)

Synonyme: 1110046L09Rik antikoerper, 2310061C15Rik antikoerper, DC13 antikoerper, C16orf61 antikoerper, C18H16orf61 antikoerper, si:busm1-241h12.4 antikoerper, si:dz241h12.4 antikoerper, zgc:92271 antikoerper, C-x(9)-C motif containing 2 antikoerper, C-x(9)-C motif containing 2 S homeolog antikoerper, COX assembly mitochondrial protein 2 antikoerper, C-X9-C motif containing 2 antikoerper, cmc2 antikoerper, cmc2.S antikoerper, CMC2 antikoerper, Cmc2 antikoerper

Hintergrund: The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 9 kDa (MW of target protein)