CTDSP2 Antikörper
-
- Target Alle CTDSP2 Antikörper anzeigen
- CTDSP2 (CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CTDSP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA
- Top Product
- Discover our top product CTDSP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CTDSP2 Blocking Peptide, catalog no. 33R-1545, is also available for use as a blocking control in assays to test for specificity of this CTDSP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTDSP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTDSP2 (CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2))
- Andere Bezeichnung
- CTDSP2 (CTDSP2 Produkte)
- Synonyme
- fb16c04 antikoerper, wu:fb16c04 antikoerper, zgc:77714 antikoerper, MGC68415 antikoerper, CTDSP2 antikoerper, OS4 antikoerper, PSR2 antikoerper, SCP2 antikoerper, AI586070 antikoerper, D10Ertd73e antikoerper, OS-4 antikoerper, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2 antikoerper, CTD small phosphatase 2 L homeolog antikoerper, CTD small phosphatase 2 antikoerper, ctdsp2 antikoerper, ctdsp2.L antikoerper, CTDSP2 antikoerper, Ctdsp2 antikoerper
- Hintergrund
- CTDSP2 negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. CTDSP2 is recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing. in non-neuronal cells.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-