IPPK Antikörper (Middle Region)

Produktnummer ABIN632070

Produktdetails anti-IPPK Antikörper

Target: IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IPPK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IPPK antibody was raised against the middle region of IPPK

Aufreinigung: Affinity purified

Immunogen: IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IPPK Blocking Peptide, catalog no. 33R-4685, is also available for use as a blocking control in assays to test for specificity of this IPPK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPPK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IPPK

Target: IPPK (Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase (IPPK))

Andere Bezeichnung: IPPK (IPPK Produkte)

Synonyme: IPPK antikoerper, MGC146756 antikoerper, C9orf12 antikoerper, INSP5K2 antikoerper, IP5K antikoerper, IPK1 antikoerper, bA476B13.1 antikoerper, 1810043M15Rik antikoerper, InsP6 antikoerper, RGD1311271 antikoerper, rIpk1 antikoerper, ipk1 antikoerper, ipk1l antikoerper, si:dkey-42i9.3 antikoerper, zgc:110769 antikoerper, ATIPK1 antikoerper, M40H3 antikoerper, MJB21.19 antikoerper, MJB21_19 antikoerper, inositol-pentakisphosphate 2-kinase 1 antikoerper, inositol-pentakisphosphate 2-kinase antikoerper, inositol 1,3,4,5,6-pentakisphosphate 2-kinase antikoerper, inositol pentakisphosphate 2-kinase antikoerper, inositol-pentakisphosphate 2-kinase 1 antikoerper, IPPK antikoerper, LOC521083 antikoerper, ippk antikoerper, Ippk antikoerper, IPK1 antikoerper

Hintergrund: IPPK phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 is involved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. It also protects cells from TNF-alpha-induced apoptosis.

Molekulargewicht: 56 kDa (MW of target protein)