ARL8B Antikörper (Middle Region)
-
- Target Alle ARL8B Antikörper anzeigen
- ARL8B (ADP-Ribosylation Factor-Like 8B (ARL8B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARL8B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARL8 B antibody was raised against the middle region of ARL8
- Aufreinigung
- Affinity purified
- Immunogen
- ARL8 B antibody was raised using the middle region of ARL8 corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL
- Top Product
- Discover our top product ARL8B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARL8B Blocking Peptide, catalog no. 33R-1997, is also available for use as a blocking control in assays to test for specificity of this ARL8B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARL8B (ADP-Ribosylation Factor-Like 8B (ARL8B))
- Andere Bezeichnung
- ARL8B (ARL8B Produkte)
- Synonyme
- ARL10C antikoerper, Gie1 antikoerper, 2610313E07Rik antikoerper, 3100002J04Rik antikoerper, Arl10c antikoerper, gie1 antikoerper, ADP ribosylation factor like GTPase 8B antikoerper, ADP-ribosylation factor-like 8B antikoerper, ADP-ribosylation factor like GTPase 8B antikoerper, ARL8B antikoerper, Arl8b antikoerper
- Hintergrund
- ARL8B may play a role in lysosome motility and chromosome segregation.
- Molekulargewicht
- 21 kDa (MW of target protein)
-