VPS53 Antikörper
-
- Target Alle VPS53 Antikörper anzeigen
- VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS53 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK
- Top Product
- Discover our top product VPS53 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS53 Blocking Peptide, catalog no. 33R-9919, is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS53 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))
- Andere Bezeichnung
- VPS53 (VPS53 Produkte)
- Synonyme
- wu:fb77d11 antikoerper, zgc:103741 antikoerper, DKFZp469N152 antikoerper, 2010002A08Rik antikoerper, 2310040I21Rik antikoerper, 3100002B05Rik antikoerper, Hccs1 antikoerper, HCCS1 antikoerper, hVps53L antikoerper, pp13624 antikoerper, RGD1311391 antikoerper, VPS53, GARP complex subunit antikoerper, vacuolar protein sorting 53 homolog (S. cerevisiae) antikoerper, vacuolar protein sorting 53 antikoerper, VPS53 GARP complex subunit antikoerper, VPS53 antikoerper, vps53 antikoerper, PAAG_00802 antikoerper, MCYG_06020 antikoerper, VDBG_07188 antikoerper, MGYG_05943 antikoerper, Vps53 antikoerper
- Hintergrund
- This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.
- Molekulargewicht
- 92 kDa (MW of target protein)
-