CYP11B2 Antikörper (Middle Region)

Produktnummer ABIN632030

Produktdetails anti-CYP11B2 Antikörper

Target: CYP11B2 (Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP11B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP11 B2 antibody was raised against the middle region of CYP11 2

Aufreinigung: Affinity purified

Immunogen: CYP11 B2 antibody was raised using the middle region of CYP11 2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP11B2 Blocking Peptide, catalog no. 33R-8145, is also available for use as a blocking control in assays to test for specificity of this CYP11B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP10 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP11B2

Target: CYP11B2 (Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2))

Andere Bezeichnung: CYP11B2 (CYP11B2 Produkte)

Synonyme: ALDOS antikoerper, CPN2 antikoerper, CYP11B antikoerper, CYP11BL antikoerper, CYPXIB2 antikoerper, P-450C18 antikoerper, P450C18 antikoerper, P450aldo antikoerper, Cpn2 antikoerper, Cyp11b antikoerper, Cyp11b-2 antikoerper, Cp45as antikoerper, Cyp11b3 antikoerper, RNCP45AS antikoerper, cytochrome P450 family 11 subfamily B member 2 antikoerper, cytochrome P450, family 11, subfamily b, polypeptide 2 antikoerper, aldosterone synthase antikoerper, cytochrome P450, family 11, subfamily B, polypeptide 2 antikoerper, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2 antikoerper, CYP11B2 antikoerper, Cyp11b2 antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process, Feeding Behaviour