PSG6 Antikörper (N-Term)

Produktnummer ABIN631999

Produktdetails anti-PSG6 Antikörper

Target: PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSG6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PSG6 antibody was raised against the N terminal of PSG6

Aufreinigung: Affinity purified

Immunogen: PSG6 antibody was raised using the N terminal of PSG6 corresponding to a region with amino acids VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSG6 Blocking Peptide, catalog no. 33R-9675, is also available for use as a blocking control in assays to test for specificity of this PSG6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSG6

Target: PSG6 (Pregnancy Specific beta-1-Glycoprotein 6 (PSG6))

Andere Bezeichnung: PSG6 (PSG6 Produkte)

Synonyme: PSBG-10 antikoerper, PSBG-12 antikoerper, PSBG-6 antikoerper, PSG10 antikoerper, PSGGB antikoerper, PSG6 antikoerper, PSG3 antikoerper, pregnancy specific beta-1-glycoprotein 6 antikoerper, pregnancy-specific beta-1-glycoprotein 4 antikoerper, PSG6 antikoerper, LOC456082 antikoerper

Hintergrund: PSG6 may have a role in modulation of the innate immune system.

Molekulargewicht: 47 kDa (MW of target protein)