FUNDC1 Antikörper (Middle Region)
-
- Target Alle FUNDC1 Antikörper anzeigen
- FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FUNDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FUNDC1 antibody was raised against the middle region of FUNDC1
- Aufreinigung
- Affinity purified
- Immunogen
- FUNDC1 antibody was raised using the middle region of FUNDC1 corresponding to a region with amino acids TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN
- Top Product
- Discover our top product FUNDC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FUNDC1 Blocking Peptide, catalog no. 33R-8988, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))
- Andere Bezeichnung
- FUNDC1 (FUNDC1 Produkte)
- Synonyme
- fundc1-a antikoerper, 1500005J14Rik antikoerper, 1810033P05Rik antikoerper, zgc:92600 antikoerper, FUN14 domain-containing protein 1-like antikoerper, FUN14 domain containing 1 S homeolog antikoerper, FUN14 domain containing 1 antikoerper, LOC100357289 antikoerper, fundc1.S antikoerper, FUNDC1 antikoerper, Fundc1 antikoerper, fundc1 antikoerper
- Hintergrund
- FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
- Molekulargewicht
- 17 kDa (MW of target protein)
-