GCLM Antikörper (Middle Region)

Produktnummer ABIN631928

Produktdetails anti-GCLM Antikörper

Target: GCLM (Glutamate-Cysteine Ligase, Modifier Subunit (GCLM))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCLM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GCLM antibody was raised against the middle region of GCLM

Aufreinigung: Affinity purified

Immunogen: GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCLM Blocking Peptide, catalog no. 33R-4592, is also available for use as a blocking control in assays to test for specificity of this GCLM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCLM

Target: GCLM (Glutamate-Cysteine Ligase, Modifier Subunit (GCLM))

Andere Bezeichnung: GCLM (GCLM Produkte)

Synonyme: Glclr antikoerper, GLCLR antikoerper, id:ibd3182 antikoerper, wu:fi24c07 antikoerper, zgc:55903 antikoerper, AI649393 antikoerper, Gcmc antikoerper, glutamate-cysteine ligase regulatory subunit antikoerper, glutamate cysteine ligase, modifier subunit antikoerper, glutamate-cysteine ligase modifier subunit antikoerper, glutamate-cysteine ligase, modifier subunit antikoerper, glutamate-cysteine ligase, modifier subunit L homeolog antikoerper, PTRG_09814 antikoerper, Gclm antikoerper, GCLM antikoerper, gclm antikoerper, gclm.L antikoerper

Hintergrund: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis.

Molekulargewicht: 31 kDa (MW of target protein)