EARS2 Antikörper

Produktnummer ABIN631902

Produktdetails anti-EARS2 Antikörper

Target: EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EARS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EARS2 Blocking Peptide, catalog no. 33R-8975, is also available for use as a blocking control in assays to test for specificity of this EARS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EARS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EARS2

Target: EARS2 (Glutamyl-tRNA Synthetase 2 Mitochondrial (EARS2))

Andere Bezeichnung: EARS2 (EARS2 Produkte)

Synonyme: mse1 antikoerper, 3230401I01Rik antikoerper, AL024049 antikoerper, mKIAA1970 antikoerper, COXPD12 antikoerper, MSE1 antikoerper, RGD1307904 antikoerper, ears2 antikoerper, glutamyl-tRNA synthetase 2, mitochondrial antikoerper, zgc:153247 antikoerper, EARS2 antikoerper, ears2 antikoerper, Ears2 antikoerper, zgc:153247 antikoerper

Hintergrund: EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.

Molekulargewicht: 59 kDa (MW of target protein)