NUDCD3 Antikörper (Middle Region)
-
- Target Alle NUDCD3 Antikörper anzeigen
- NUDCD3 (NudC Domain Containing 3 (NUDCD3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUDCD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NUDCD3 antibody was raised against the middle region of NUDCD3
- Aufreinigung
- Affinity purified
- Immunogen
- NUDCD3 antibody was raised using the middle region of NUDCD3 corresponding to a region with amino acids KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD
- Top Product
- Discover our top product NUDCD3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUDCD3 Blocking Peptide, catalog no. 33R-4441, is also available for use as a blocking control in assays to test for specificity of this NUDCD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUDCD3 (NudC Domain Containing 3 (NUDCD3))
- Andere Bezeichnung
- NUDCD3 (NUDCD3 Produkte)
- Synonyme
- NudCL antikoerper, AI427847 antikoerper, BC024322 antikoerper, RP23-28G13.2 antikoerper, mKIAA1068 antikoerper, NudC domain containing 3 antikoerper, Nudcd3 antikoerper, NUDCD3 antikoerper
- Hintergrund
- The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain and mislocalization of the dynein complex from kinetochores.
- Molekulargewicht
- 41 kDa (MW of target protein)
-