GCOM1 Antikörper (Middle Region)
-
- Target Alle GCOM1 Antikörper anzeigen
- GCOM1 (GRINL1A Complex Locus (GCOM1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GCOM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GCOM1 antibody was raised against the middle region of Gcom1
- Aufreinigung
- Affinity purified
- Immunogen
- GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
- Top Product
- Discover our top product GCOM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GCOM1 Blocking Peptide, catalog no. 33R-9433, is also available for use as a blocking control in assays to test for specificity of this GCOM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCOM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCOM1 (GRINL1A Complex Locus (GCOM1))
- Andere Bezeichnung
- GCOM1 (GCOM1 Produkte)
- Synonyme
- GRINL1A antikoerper, Gcom2 antikoerper, MYZAP antikoerper, MYZAP-POLR2M antikoerper, gcom antikoerper, GRINL1A complex locus 1 antikoerper, GCOM1 antikoerper
- Hintergrund
- This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants.
- Molekulargewicht
- 52 kDa (MW of target protein)
-