RSL24D1 Antikörper (Middle Region)

Produktnummer ABIN631795

Produktdetails anti-RSL24D1 Antikörper

Target: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSL24D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C15 ORF15 antibody was raised against the middle region of C15 rf15

Aufreinigung: Affinity purified

Immunogen: C15 ORF15 antibody was raised using the middle region of C15 rf15 corresponding to a region with amino acids KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C15ORF15 Blocking Peptide, catalog no. 33R-4271, is also available for use as a blocking control in assays to test for specificity of this C15ORF15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSL24D1

Target: RSL24D1 (Ribosomal L24 Domain Containing 1 (RSL24D1))

Andere Bezeichnung: C15ORF15 (RSL24D1 Produkte)

Synonyme: C15orf15 antikoerper, HRP-L30-iso antikoerper, L30 antikoerper, RLP24 antikoerper, RPL24 antikoerper, RPL24L antikoerper, TVAS3 antikoerper, 2410159K22Rik antikoerper, RGD1309784 antikoerper, c15orf15 antikoerper, wu:fa94f12 antikoerper, wu:fa95d02 antikoerper, zgc:56202 antikoerper, ribosomal L24 domain containing 1 antikoerper, RSL24D1 antikoerper, Rsl24d1 antikoerper, rsl24d1 antikoerper

Hintergrund: This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals.

Molekulargewicht: 19 kDa (MW of target protein)