TSPY-Like 4 Antikörper (Middle Region)

Produktnummer ABIN631764

Produktdetails anti-TSPY-Like 4 Antikörper

Target: TSPY-Like 4 (TSPYL4)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPY-Like 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TSPYL4 antibody was raised against the middle region of TSPYL4

Aufreinigung: Affinity purified

Immunogen: TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSPYL4 Blocking Peptide, catalog no. 33R-7599, is also available for use as a blocking control in assays to test for specificity of this TSPYL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPY-Like 4

Target: TSPY-Like 4 (TSPYL4)

Andere Bezeichnung: TSPYL4 (TSPYL4 Produkte)

Synonyme: dJ486I3.2 antikoerper, 2610102M01Rik antikoerper, B230210I21Rik antikoerper, D10Bwg0791e antikoerper, TSPY like 4 antikoerper, TSPY-like 4 antikoerper, TSPYL4 antikoerper, Tspyl4 antikoerper

Hintergrund: TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Molekulargewicht: 45 kDa (MW of target protein)