RNASE9 Antikörper
-
- Target Alle RNASE9 Antikörper anzeigen
- RNASE9 (Ribonuclease, RNase A Family, 9 (Non-Active) (RNASE9))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNASE9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RNASE9 antibody was raised using a synthetic peptide corresponding to a region with amino acids PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH
- Top Product
- Discover our top product RNASE9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNASE9 Blocking Peptide, catalog no. 33R-7036, is also available for use as a blocking control in assays to test for specificity of this RNASE9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASE9 (Ribonuclease, RNase A Family, 9 (Non-Active) (RNASE9))
- Andere Bezeichnung
- RNASE9 (RNASE9 Produkte)
- Synonyme
- HEL128 antikoerper, h461 antikoerper, ESRL antikoerper, ribonuclease A family member 9 (inactive) antikoerper, ribonuclease, RNase A family, 9 (non-active) antikoerper, RNASE9 antikoerper, Rnase9 antikoerper
- Hintergrund
- RNASE9 belongs to the pancreatic ribonuclease family. It may be involved in host defense.
- Molekulargewicht
- 24 kDa (MW of target protein)
-