UPP1 Antikörper (Middle Region)
-
- Target Alle UPP1 Antikörper anzeigen
- UPP1 (Uridine Phosphorylase 1 (UPP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UPP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UPP1 antibody was raised against the middle region of UPP1
- Aufreinigung
- Affinity purified
- Immunogen
- UPP1 antibody was raised using the middle region of UPP1 corresponding to a region with amino acids ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSK
- Top Product
- Discover our top product UPP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UPP1 Blocking Peptide, catalog no. 33R-1068, is also available for use as a blocking control in assays to test for specificity of this UPP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UPP1 (Uridine Phosphorylase 1 (UPP1))
- Andere Bezeichnung
- UPP1 (UPP1 Produkte)
- Synonyme
- upp1 antikoerper, UDRPASE antikoerper, UP antikoerper, UPASE antikoerper, UPP antikoerper, im:6911242 antikoerper, zgc:110755 antikoerper, AI325217 antikoerper, UPase antikoerper, UdRPase antikoerper, Up antikoerper, Upp antikoerper, uridine phosphorylase 1 antikoerper, uridine phosphorylase antikoerper, upp1 antikoerper, NP_RS08675 antikoerper, Tsp_02326 antikoerper, UPP1 antikoerper, Upp1 antikoerper
- Hintergrund
- UPP1 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-