NME4 Antikörper (Middle Region)
-
- Target Alle NME4 Antikörper anzeigen
- NME4 (NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NME4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NME4 antibody was raised against the middle region of NME4
- Aufreinigung
- Affinity purified
- Immunogen
- NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV
- Top Product
- Discover our top product NME4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NME4 Blocking Peptide, catalog no. 33R-9429, is also available for use as a blocking control in assays to test for specificity of this NME4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NME4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NME4 (NME/NM23 Nucleoside Diphosphate Kinase 4 (NME4))
- Andere Bezeichnung
- NME4 (NME4 Produkte)
- Synonyme
- NDPK-D antikoerper, NM23H4 antikoerper, nm23-H4 antikoerper, 2610027N22Rik antikoerper, 2810024O08Rik antikoerper, 5730493H09Rik antikoerper, NM23-M4 antikoerper, Nm23M4 antikoerper, NME/NM23 nucleoside diphosphate kinase 4 antikoerper, NME4 antikoerper, Nme4 antikoerper
- Hintergrund
- The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-