FBXO8 Antikörper (Middle Region)

Produktnummer ABIN631700

Produktdetails anti-FBXO8 Antikörper

Target: FBXO8 (F-Box Protein 8 (FBXO8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO8 antibody was raised against the middle region of FBXO8

Aufreinigung: Affinity purified

Immunogen: FBXO8 antibody was raised using the middle region of FBXO8 corresponding to a region with amino acids EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO8 Blocking Peptide, catalog no. 33R-2402, is also available for use as a blocking control in assays to test for specificity of this FBXO8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO8

Target: FBXO8 (F-Box Protein 8 (FBXO8))

Andere Bezeichnung: FBXO8 (FBXO8 Produkte)

Synonyme: FBXO8 antikoerper, T24I21.22 antikoerper, T24I21_22 antikoerper, zgc:136842 antikoerper, FBS antikoerper, FBX8 antikoerper, Fbx8 antikoerper, F-box protein 8 antikoerper, F-box and associated interaction domains-containing protein antikoerper, F-box protein 8 L homeolog antikoerper, FBXO8 antikoerper, fbxo8 antikoerper, AT2G16810 antikoerper, fbxo8.L antikoerper, Fbxo8 antikoerper

Hintergrund: FBXO8 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO8 belongs to the Fbxs class.

Molekulargewicht: 37 kDa (MW of target protein)