GRK4 Antikörper (Middle Region)

Produktnummer ABIN631696

Produktdetails anti-GRK4 Antikörper

Target: GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRK4 antibody was raised against the middle region of GRK4

Aufreinigung: Affinity purified

Immunogen: GRK4 antibody was raised using the middle region of GRK4 corresponding to a region with amino acids QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRK4 Blocking Peptide, catalog no. 33R-7734, is also available for use as a blocking control in assays to test for specificity of this GRK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRK4

Target: GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))

Andere Bezeichnung: GRK4 (GRK4 Produkte)

Synonyme: GPRK2L antikoerper, GPRK4 antikoerper, GRK4a antikoerper, IT11 antikoerper, A830025H08Rik antikoerper, GRK antikoerper, Gprk2l antikoerper, Gprk4 antikoerper, AMPK antikoerper, AMPKalpha antikoerper, CG3051 antikoerper, DmAMPK alpha antikoerper, Dmel\\CG3051 antikoerper, EG:132E8.2 antikoerper, FBgn0023169 antikoerper, Gprk-4 antikoerper, ampk antikoerper, ampkalpha antikoerper, dAMPKa antikoerper, dAMPKalpha antikoerper, snf1a antikoerper, gprk4 antikoerper, gprk4-a antikoerper, grk4 antikoerper, GRK4 antikoerper, gprk4-b antikoerper, zgc:153020 antikoerper, gprk2l antikoerper, grk4a antikoerper, it11 antikoerper, G protein-coupled receptor kinase 4 antikoerper, AMP-activated protein kinase alpha subunit antikoerper, G protein-coupled receptor kinase 4 L homeolog antikoerper, G protein-coupled receptor kinase 4 S homeolog antikoerper, GRK4 antikoerper, Grk4 antikoerper, AMPKalpha antikoerper, grk4.L antikoerper, grk4.S antikoerper, grk4 antikoerper, LOC100540688 antikoerper

Hintergrund: GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling