NEDD4 Antikörper (Middle Region)

Produktnummer ABIN631663

Produktdetails anti-NEDD4 Antikörper

Target: NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEDD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NEDD4 antibody was raised against the middle region of NEDD4

Aufreinigung: Affinity purified

Immunogen: NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEDD4 Blocking Peptide, catalog no. 33R-8771, is also available for use as a blocking control in assays to test for specificity of this NEDD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEDD4

Target: NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))

Andere Bezeichnung: NEDD4 (NEDD4 Produkte)

Synonyme: NEDD4-1 antikoerper, RPF1 antikoerper, AA959633 antikoerper, AL023035 antikoerper, AU019897 antikoerper, E430025J12Rik antikoerper, Nedd4-1 antikoerper, Nedd4a antikoerper, mKIAA0093 antikoerper, CG32184 antikoerper, CG42279 antikoerper, CG7555 antikoerper, DNedd4 antikoerper, Dmel\\CG42279 antikoerper, Dmel_CG32184 antikoerper, Dmel_CG7555 antikoerper, dNedd4 antikoerper, dNedd4-1 antikoerper, nedd4 antikoerper, GB16853 antikoerper, NEDD4 antikoerper, Nedd4 antikoerper, neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase antikoerper, neural precursor cell expressed, developmentally down-regulated 4 antikoerper, CG42279 gene product from transcript CG42279-RJ antikoerper, E3 ubiquitin-protein ligase Nedd-4 antikoerper, E3 ubiquitin-protein ligase NEDD4 antikoerper, NEDD4 antikoerper, Nedd4 antikoerper, LOC411723 antikoerper, LOC100457150 antikoerper, nedd4 antikoerper, LOC100547485 antikoerper

Hintergrund: NEDD4 is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4 is involved in the budding of many viruses.

Molekulargewicht: 104 kDa (MW of target protein)

Pathways: Notch Signalweg, Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development, Signaling Events mediated by VEGFR1 and VEGFR2