SMARCD1 Antikörper (Middle Region)
-
- Target Alle SMARCD1 Antikörper anzeigen
- SMARCD1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMARCD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SMARCD1 antibody was raised against the middle region of Smarcd1
- Aufreinigung
- Affinity purified
- Immunogen
- SMARCD1 antibody was raised using the middle region of Smarcd1 corresponding to a region with amino acids RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
- Top Product
- Discover our top product SMARCD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMARCD1 Blocking Peptide, catalog no. 33R-8003, is also available for use as a blocking control in assays to test for specificity of this SMARCD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMARCD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMARCD1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily D, Member 1 (SMARCD1))
- Andere Bezeichnung
- SMARCD1 (SMARCD1 Produkte)
- Synonyme
- rsc6p antikoerper, baf60a antikoerper, cracd1 antikoerper, MGC69403 antikoerper, BAF60A antikoerper, CRACD1 antikoerper, Rsc6p antikoerper, wu:fa10h07 antikoerper, wu:fb82d01 antikoerper, wu:fi45f10 antikoerper, AA407987 antikoerper, Baf60a antikoerper, D15Kz1 antikoerper, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 antikoerper, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 L homeolog antikoerper, SMARCD1 antikoerper, smarcd1 antikoerper, smarcd1.L antikoerper, Smarcd1 antikoerper
- Hintergrund
- SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.
- Molekulargewicht
- 58 kDa (MW of target protein)
-