AGO4 Antikörper (Middle Region)

Produktnummer ABIN631614

Produktdetails anti-AGO4 Antikörper

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGO4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF2 C4 antibody was raised against the middle region of EIF2 4

Aufreinigung: Affinity purified

Immunogen: EIF2 C4 antibody was raised using the middle region of EIF2 4 corresponding to a region with amino acids DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2C4 Blocking Peptide, catalog no. 33R-1952, is also available for use as a blocking control in assays to test for specificity of this EIF2C4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGO4

Target: AGO4 (EIF2C4) (Eukaryotic Translation Initiation Factor 2C, 4 (EIF2C4))

Andere Bezeichnung: EIF2C4 (EIF2C4 Produkte)

Synonyme: EIF2C4 antikoerper, ago4 antikoerper, Argonaute4 antikoerper, argonaute-4 antikoerper, eif2c4 antikoerper, wu:fd14f04 antikoerper, ARGONAUTE 4 antikoerper, OCP11 antikoerper, OVEREXPRESSOR OF CATIONIC PEROXIDASE 11 antikoerper, T20P8.9 antikoerper, T20P8_9 antikoerper, Eif2c4 antikoerper, 5730550L01Rik antikoerper, AI481660 antikoerper, argonaute 4, RISC catalytic component antikoerper, argonaute 1, RISC catalytic component antikoerper, argonaute RISC catalytic component 4 antikoerper, Argonaute family protein antikoerper, argonaute 4, RISC catalytic component L homeolog antikoerper, argonaute RISC catalytic subunit 4 antikoerper, AGO4 antikoerper, ago1 antikoerper, ago4 antikoerper, Ago4 antikoerper, ago4.L antikoerper

Hintergrund: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing.

Molekulargewicht: 95 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulatorische RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Cellular Glucan Metabolic Process