DPCD Antikörper (N-Term)

Produktnummer ABIN631571

Produktdetails anti-DPCD Antikörper

Target: DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DPCD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RP11-529 I10.4 antibody was raised against the N terminal of RP11-529 10.4

Aufreinigung: Affinity purified

Immunogen: RP11-529 I10.4 antibody was raised using the N terminal of RP11-529 10.4 corresponding to a region with amino acids MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP11-529I10.4 Blocking Peptide, catalog no. 33R-5635, is also available for use as a blocking control in assays to test for specificity of this RP11-529I10.4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-520 10.4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DPCD

Target: DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))

Andere Bezeichnung: RP11-529I10.4 (DPCD Produkte)

Synonyme: RP11-529I10.4 antikoerper, zgc:153412 antikoerper, rp11-529i10.4 antikoerper, 5330431N19Rik antikoerper, Ndac antikoerper, RGD1307648 antikoerper, deleted in primary ciliary dyskinesia homolog (mouse) antikoerper, deleted in a mouse model of primary ciliary dyskinesia S homeolog antikoerper, deleted in primary ciliary dyskinesia antikoerper, DPCD antikoerper, dpcd antikoerper, dpcd.S antikoerper, Dpcd antikoerper

Hintergrund: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Molekulargewicht: 23 kDa (MW of target protein)